Please Input keywords you interested to search our products. the keywords can be the attribute value of the product you looking for, could be from species, source,name,catalog, and so on.

Recombinant Human Tumor Necrosis Factor Receptor Superfamily Member 17/TNFRSF17/BCMA/CD269 (C-6His)
This item is currently unavailable with an estimated lead time of 1-2 months: Inquiry
Catalog#CC28
SourceYeast
DescriptionRecombinant Human Tumor Necrosis Factor Receptor Superfamily Member 17 is produced by our P.Pichia expression system and the target gene encoding Met1-Ala54 is expressed with a 6His tag at the C-terminus.
NamesTumor necrosis factor receptor superfamily member 17; B-cell maturation protein; CD269; TNFRSF17; BCM; BCMA
Accession #Q02223
FormulationLyophilized from a 0.2 μm filtered solution of PBS, pH7.4.
ShippingThe product is shipped at ambient temperature.
ReconstitutionAlways centrifuge tubes before opening. Do not mix by vortex or pipetting.
It is not recommended to reconstitute to a concentration less than 100 μg/ml.
Dissolve the lyophilized protein in ddH2O.
Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
StorageLyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks.
Reconstituted protein solution can be stored at 4-7°C for 2-7 days.
Aliquots of reconstituted samples are stable at < -20°C for 3 months.
PurityGreater than 90% as determined by reducing SDS-PAGE.
EndotoxinLess than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence
MRFPSIFTAVLFAASSALAAPVNTTTEDETAQIPAEAVIGYSDLEGDFDVAVLPFSNSTNNGLLF INTTIASIAAKEEGVSLEKREAEAMLQMAGQCSQNEYFDSLLHACIPCQLRCSSNTPPLTCQRYC NASVTNSVKGTNAGSHHHHHH
BackgroundB cell maturation antigen (BCMA) is a member of the TNF receptor superfamily. It has been designated TNFRSF17. Human BCMA is a 184 amino acid (aa) protein consisting of a 54 aa extracellular domain, a 23 aa transmembrane domain, and a 107 aa intracellular domain. BCMA is a type III membrane protein containing one extracellular cysteine rich domain. Within the TNFRSF, it shares the highest homology with TACI. BCMA and TACI have both been shown to bind to APRIL and BAFF, members of the TNF ligand superfamily. BCMA expression has been found in immune organs and mature B cell lines. Although some expression has been observed at the cell surface, BCMA appears to be localized to the Golgi compartment. The binding of BCMA to APRIL or BAFF has been shown to stimulate IgM production in peripheral blood B cells and increase the survival of cultured B cells. This data suggests that BCMA may play an important role in B cell development,function and regulation.

This is a new product. Please enter your email address below, and our service team will send you the data sheet.

We apologize for the inconvenience, and we are working at our best to update the missing information.

Your Email:

This is a new product. Please enter your email address below, and our service team will send you the MSDS.

We apologize for the inconvenience, and we are working at our best to update the missing information.

Your Email:

CC28 has not been referenced in any publication so far.

We will update the citation once any published work comes in our awareness. Please check back!