Please Input keywords you interested to search our products. the keywords can be the attribute value of the product you looking for, could be from species, source,name,catalog, and so on.

Recombinant Human TRAIL R4/TNFRSF10D/CD264 (C-Fc)
$70.00
Catalog#CU11
SourceHuman Cells
DescriptionRecombinant Human Tumor Necrosis Factor Receptor Superfamily Member 10D is produced by our Mammalian expression system and the target gene encoding Ala56-His211 is expressed with a Fc tag at the C-terminus.
NamesTumor necrosis factor receptor superfamily member 10D; Decoy receptor 2; DcR2; TNF-related apoptosis-inducing ligand receptor 4; TRAIL receptor 4; TRAIL-R4; TRAIL receptor with a truncated death domain; CD264; TNFRSF10D; DCR2; TRAILR4; TRUNDD
Accession #Q9UBN6
FormulationLyophilized from a 0.2 μm filtered solution of PBS, pH7.4.
ShippingThe product is shipped at ambient temperature.
ReconstitutionAlways centrifuge tubes before opening. Do not mix by vortex or pipetting.
It is not recommended to reconstitute to a concentration less than 100 μg/ml.
Dissolve the lyophilized protein in ddH2O.
Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
StorageLyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks.
Reconstituted protein solution can be stored at 4-7°C for 2-7 days.
Aliquots of reconstituted samples are stable at < -20°C for 3 months.
PurityGreater than 95% as determined by reducing SDS-PAGE.
EndotoxinLess than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence
ATIPRQDEVPQQTVAPQQQRRSLKEEECPAGSHRSEYTGACNPCTEGVDYTIASNNLPSCLLCTV CKSGQTNKSSCTTTRDTVCQCEKGSFQDKNSPEMCRTCRTGCPRGMVKVSNCTPRSDIKCKNESA ASSTGKTPAAEETVTTILGMLASPYHIEGRIDPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKD TLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWL NGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAV EWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLS PGK
BackgroundHuman TRAIL R4 is a type 1, TNF R family membrane protein, which is a receptor for TRAIL (APO2 ligand). TRAIL R4 contains an extracellular TRAIL-binding domain, a transmembrane domain, and a truncated cytoplasmic death domain. In the new TNF superfamily nomenclature, TRAIL R4 is referred to as TNFRSF10D. TRAIL R4 is unique among the TRAIL receptors in that its cytoplasmic domain contains a truncated consensus death domain motif. Binding of TRAIL R4 does not result in an apoptotic signal. Overexpression of TRAIL R4 can protect cells bearing TRAIL R1 and/or TRAIL R2 from TRAIL mediated apoptosis. The human soluble TRAIL R4/Fc chimera neutralizes the ability of TRAIL to induce apoptosis.

This is a new product. Please enter your email address below, and our service team will send you the data sheet.

We apologize for the inconvenience, and we are working at our best to update the missing information.

Your Email:

This is a new product. Please enter your email address below, and our service team will send you the MSDS.

We apologize for the inconvenience, and we are working at our best to update the missing information.

Your Email:

CU11 has not been referenced in any publication so far.

We will update the citation once any published work comes in our awareness. Please check back!