Please Input keywords you interested to search our products. the keywords can be the attribute value of the product you looking for, could be from species, source,name,catalog, and so on.

Recombinant Human Neprilysin/CD10 (N-8xHis)
$150.00
Catalog#CU08
SourceHuman Cells
DescriptionRecombinant Human Neprilysin is produced by our Mammalian expression system and the target gene encoding Tyr52-Trp750 is expressed with a 8His tag at the N-terminus.
NamesNeprilysin; Atriopeptidase; Common acute lymphocytic leukemia antigen; CALLA; Enkephalinase; Neutral endopeptidase 24.11; NEP; Neutral endopeptidase; Skin fibroblast elastase; SFE; CD10; MME; EPN
Accession #P08473
FormulationSupplied as a 0.2 μm filtered solution of PBS, pH7.4.
ShippingThe product is shipped on dry ice/ice packs.
StorageStore at < -20°C, stable for 6 months after receipt.
Please minimize freeze-thaw cycles.
PurityGreater than 95% as determined by reducing SDS-PAGE.
EndotoxinLess than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence
HHHHHHHHYDDGICKSSDCIKSAARLIQNMDATTEPCTDFFKYACGGWLKRNVIPETSSRYGNFD ILRDELEVVLKDVLQEPKTEDIVAVQKAKALYRSCINESAIDSRGGEPLLKLLPDIYGWPVATEN WEQKYGASWTAEKAIAQLNSKYGKKVLINLFVGTDDKNSVNHVIHIDQPRLGLPSRDYYECTGIY KEACTAYVDFMISVARLIRQEERLPIDENQLALEMNKVMELEKEIANATAKPEDRNDPMLLYNKM TLAQIQNNFSLEINGKPFSWLNFTNEIMSTVNISITNEEDVVVYAPEYLTKLKPILTKYSARDLQ NLMSWRFIMDLVSSLSRTYKESRNAFRKALYGTTSETATWRRCANYVNGNMENAVGRLYVEAAFA GESKHVVEDLIAQIREVFIQTLDDLTWMDAETKKRAEEKALAIKERIGYPDDIVSNDNKLNNEYL ELNYKEDEYFENIIQNLKFSQSKQLKKLREKVDKDEWISGAAVVNAFYSSGRNQIVFPAGILQPP FFSAQQSNSLNYGGIGMVIGHEITHGFDDNGRNFNKDGDLVDWWTQQSASNFKEQSQCMVYQYGN FSWDLAGGQHLNGINTLGENIADNGGLGQAYRAYQNYIKKNGEEKLLPGLDLNHKQLFFLNFAQV WCGTYRPEYAVNSIKTDVHSPGNFRIIGTLQNSAEFSEAFHCRKNSYMNPEKKCRVW
BackgroundNeprilysin/CD10(NEP) is a zinc metallopeptidase expressed at the cell surface of a variety of cells. The functions is both as an endopeptidase with a thermolysin-like specificity and as a dipeptidyl-carboxypeptidase. NEP has been shown to be involved in the degradation of enkephalins in the mammalian brain and the inactivation of circulating atrial natriuretic peptide. NEP has also been identified as the common acute lymphocytic leukemia antigen (CALLA), and is expressed on the surface of lymphocytes in some disease states. These and other observations have resulted in considerable interest in NEP as a target for analgesics and antihypertensive drugs. NEP is also a major degrading enzyme of amyloid β peptide (Aβ) in the brain, indicating that down-regulation of NEP activity, which could be caused by aging, can contribute to the development of Alzheimer’s disease by promoting Aβ accumulation.

This is a new product. Please enter your email address below, and our service team will send you the data sheet.

We apologize for the inconvenience, and we are working at our best to update the missing information.

Your Email:

This is a new product. Please enter your email address below, and our service team will send you the MSDS.

We apologize for the inconvenience, and we are working at our best to update the missing information.

Your Email:

CU08 has not been referenced in any publication so far.

We will update the citation once any published work comes in our awareness. Please check back!