Please Input keywords you interested to search our products. the keywords can be the attribute value of the product you looking for, could be from species, source,name,catalog, and so on.

Recombinant Human Fibroblast Growth Factor 2/FGF-2/bFGF (K128N)
$70.00
Catalog#CH88
SourceE. coli
DescriptionRecombinant Human Thermostable Fibroblast Growth Factor 2(K128N) is produced by our E.coli expression system and the target gene encoding Met1-Ser155 is expressed.
NamesFibroblast growth factor 2; FGF-2; Basic fibroblast growth factor; bFGF; Heparin-binding growth factor 2; HBGF-2; FGF2; FGFB
Accession #P09038-2
FormulationLyophilized from a 0.2 μm filtered solution of 20mM Tris,200mM NaCl, pH7.5.
ShippingThe product is shipped at ambient temperature.
ReconstitutionAlways centrifuge tubes before opening. Do not mix by vortex or pipetting.
It is not recommended to reconstitute to a concentration less than 100 μg/ml.
Dissolve the lyophilized protein in ddH2O.
Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
StorageLyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks.
Reconstituted protein solution can be stored at 4-7°C for 2-7 days.
Aliquots of reconstituted samples are stable at < -20°C for 10 months.
PurityGreater than 95% as determined by reducing SDS-PAGE.
EndotoxinLess than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence
MAAGSITTLPALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQ AEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKYTSWYVALNRT GQYKLGSKTGPGQKAILFLPMSAKS
BackgroundFibroblast growth factors (FGF) are a family of heparin-binding secreted proteins that stimulate cell proliferation and differentiation in a wide variety of tissues. FGFs play important roles in diverse biological functions both in vivo and in vitro, including mitogenesis, cellular migration, differentiation, angiogenesis, and wound healing. Human embryonic stem cell (hESC) cultures require FGF basic (also known as FGF-2 or bFGF) in cell culture media to remain in an undifferentiated and pluripotent state. Thermostable FGF basic was engineered for enhanced stability in culture media, without modification of its biological function. FGF basic is a required component of stem cell culture media for maintaining cells in an undifferentiated state. Because FGF basic is unstable, daily media changes are needed. The thermostable FGF basic that supports a 2-day media change schedule, so no media changes are required over a weekend. This thermostable FGF basic was more stable than FGF basic in biochemical studies, and maintained cell growth, pluripotency and differentiation potential with a 2-day feeding schedule.

This is a new product. Please enter your email address below, and our service team will send you the data sheet.

We apologize for the inconvenience, and we are working at our best to update the missing information.

Your Email:

This is a new product. Please enter your email address below, and our service team will send you the MSDS.

We apologize for the inconvenience, and we are working at our best to update the missing information.

Your Email:

CH88 has not been referenced in any publication so far.

We will update the citation once any published work comes in our awareness. Please check back!