Please Input keywords you interested to search our products. the keywords can be the attribute value of the product you looking for, could be from species, source,name,catalog, and so on.

Recombinant Human Transforming Growth Factor β-1/TGFB1
$105.00
Catalog#CA59
SourceHuman Cells
DescriptionRecombinant Human Transforming Growth Factor beta 1 is produced by our Mammalian expression system and the target gene encoding Ala279-Ser390 is expressed.
NamesTransforming Growth Factor Beta-1, TGF-Beta-1, Latency-Associated Peptide, LAP, TGFB1, TGFB
Accession #P01137
FormulationLyophilized from a 0.2 μm filtered solution of 50mM Glycine 50mM NaCl pH4.0.
ShippingThe product is shipped at ambient temperature.
ReconstitutionAlways centrifuge tubes before opening. Do not mix by vortex or pipetting.
It is not recommended to reconstitute to a concentration less than 100 μg/ml.
Dissolve the lyophilized protein in ddH2O.
Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
StorageLyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks.
Reconstituted protein solution can be stored at 4-7°C for 2-7 days.
Aliquots of reconstituted samples are stable at < -20°C for 3 months.
PurityGreater than 95% as determined by reducing SDS-PAGE.
EndotoxinLess than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence
ALDTNYCFSSTEKNCCVRQLYIDFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALY NQHNPGASAAPCCVPQALEPLPIVYYVGRKPKVEQLSNMIVRSCKCS
BackgroundTransforming Growth Factor β-1 (TGFβ-1) is a secreted protein which belongs to the TGF-β family. TGFβ-1 is abundantly expressed in bone, articular cartilage and chondrocytes and is increased in osteoarthritis (OA). TGFβ-1 performs many cellular functions, including the control of cell growth, cell proliferation, cell differentiation and apoptosis. The precursor is cleaved into a latency-associated peptide (LAP) and a mature TGFβ-1 peptide. TGFβ-1 may also form heterodimers with other TGFβ family members. It has been found that TGFβ-1 is frequently upregulated in tumor cells. Mutations in this gene results in Camurati-Engelmann disease.
References

Engineering an “infectious” Treg biomimetic through chemoselective tethering of TGF-β1 to PEG brush surfaces

This is a new product. Please enter your email address below, and our service team will send you the data sheet.

We apologize for the inconvenience, and we are working at our best to update the missing information.

Your Email:

This is a new product. Please enter your email address below, and our service team will send you the MSDS.

We apologize for the inconvenience, and we are working at our best to update the missing information.

Your Email: