Please Input keywords you interested to search our products. the keywords can be the attribute value of the product you looking for, could be from species, source,name,catalog, and so on.

Recombinant Human OX-2/MOX1/CD200 (C-6His)
$80.00
Catalog#C311
SourceHuman Cells
DescriptionRecombinant Human CD200 is produced by our Mammalian expression system and the target gene encoding Gln31-Gly232 is expressed with a 6His tag at the C-terminus.
NamesOX-2 Membrane Glycoprotein, CD200, MOX1, MOX2
Accession #P41217
FormulationLyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.4.
ShippingThe product is shipped at ambient temperature.
ReconstitutionAlways centrifuge tubes before opening. Do not mix by vortex or pipetting.
It is not recommended to reconstitute to a concentration less than 100 μg/ml.
Dissolve the lyophilized protein in ddH2O.
Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
StorageLyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks.
Reconstituted protein solution can be stored at 4-7°C for 2-7 days.
Aliquots of reconstituted samples are stable at < -20°C for 3 months.
PurityGreater than 95% as determined by reducing SDS-PAGE.
EndotoxinLess than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence
QVQVVTQDEREQLYTPASLKCSLQNAQEALIVTWQKKKAVSPENMVTFSENHGVVIQPAYKDKIN ITQLGLQNSTITFWNITLEDEGCYMCLFNTFGFGKISGTACLTVYVQPIVSLHYKFSEDHLNITC SATARPAPMVFWKVPRSGIENSTVTLSHPNGTTSVTSILHIKDPKNQVGKEVICQVLHLGTVTDF KQTVNKGVDHHHHHH
BackgroundCD200 is a transmembrane immunoregulatory protein that belongs to the immunoglobulin superfamily. It contains one Ig like V type domain and one Ig like C2 type domain in its extracelluar domain. CD200 is widely but not ubiquitously expressed. Its receptor (CD200R) is restricted primarily to mast cells, basophils, macrophages, and dendritic cells, which suggests myeloid cell regulation as the major function of CD200. CD200 and CD200R associate via their respective N-terminal Ig-like domains. In myeloid cells, CD200R initiates inhibitory signals following receptor-ligand contact. In T cells, CD200 functions as a co-stimulatory molecule independent of the CD28 pathway. In addition, CD200 also plays an important role in prevention of graft rejection, autoimmune diseases and spontaneous abortion.

This is a new product. Please enter your email address below, and our service team will send you the data sheet.

We apologize for the inconvenience, and we are working at our best to update the missing information.

Your Email:

This is a new product. Please enter your email address below, and our service team will send you the MSDS.

We apologize for the inconvenience, and we are working at our best to update the missing information.

Your Email:

C311 has not been referenced in any publication so far.

We will update the citation once any published work comes in our awareness. Please check back!