Recombinant Human Xaa-Pro Aminopeptidase 1/XPNPEP1
Our PriceQuantity

10ug/$150

50ug/$440

500ug/$1540

1mg/$2200

This is a new product. Please enter your email address below, and our service team will send you the data sheet.

We apologize for the inconvenience, and we are working at our best to update the missing information.

Your Email:

This is a new product. Please enter your email address below, and our service team will send you the MSDS.

We apologize for the inconvenience, and we are working at our best to update the missing information.

Your Email:

C193 has not been referenced in any publication so far.

We will update the citation once any published work comes in our awareness. Please check back!

Catalog#C193
SourceE. coli
DescriptionRecombinant Human Xaa-Pro Aminopeptidase 1/XPNPEP1 is produced by our E. coli expression system. The target protein is expressed with sequence (Pro2-His623) of Human XPNPEP1.
NamesXaa-Pro Aminopeptidase 1, Aminoacylproline Aminopeptidase, Cytosolic Aminopeptidase P, Soluble Aminopeptidase P, sAmp, X-Pro Aminopeptidase 1, X-Prolyl Aminopeptidase 1 Soluble, XPNPEP1, XPNPEPL, XPNPEPL1
Accession #Q9NQW7
FormulationSupplied as a 0.2 μM filtered solution of 20mM Tris-HCl, 10% Glycerol, pH 8.0
ShippingThe product is shipped on dry ice/ice packs.
StorageStore at < -20°C, stable for 6 months after receipt.
Please minimize freeze-thaw cycles.
PurityGreater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
EndotoxinLess than 0.1 ng/μg (1 IEU/μg).
Amino Acid Sequence
MPPKVTSELLRQLRQAMRNSEYVTEPIQAYIIPSGDAHQSEYIAPCDCRRAFVSGFDGSAGTAII TEEHAAMWTDGRYFLQAAKQMDSNWTLMKMGLKDTPTQEDWLVSVLPEGSRVGVDPLIIPTDYWK KMAKVLRSAGHHLIPVKENLVDKIWTDRPERPCKPLLTLGLDYTGISWKDKVADLRLKMAERNVM WFVVTALDEIAWLFNLRGSDVEHNPVFFSYAIIGLETIMLFIDGDRIDAPSVKEHLLLDLGLEAE YRIQVHPYKSILSELKALCADLSPREKVWVSDKASYAVSETIPKDHRCCMPYTPICIAKAVKNSA ESEGMRRAHIKDAVALCELFNWLEKEVPKGGVTEISAADKAEEFRRQQADFVDLSFPTISSTGPN GAIIHYAPVPETNRTLSLDEVYLIDSGAQYKDGTTDVTRTMHFGTPTAYEKECFTYVLKGHIAVS AAVFPTGTKGHLLDSFARSALWDSGLDYLHGTGHGVGSFLNVHEGPCGISYKTFSDEPLEAGMIV TDEPGYYEDGAFGIRIENVVLVVPVKTKYNFNNRGSLTFEPLTLVPIQTKMIDVDSLTDKECDWL NNYHLTCRDVIGKELQKQGRQEALEWLIRETQPISKQHHHHHH
BackgroundX-Prolyl Aminopeptidase (XPNPEP1) is a proline-specific metalloaminopeptidase that specifically catalyzes the removal of any unsubstituted N-terminal amino acid that is adjacent to a penultimate proline residue. Because of its specificity toward proline, it has been suggested that X-Prolyl Aminopeptidase is important in the maturation and degradation of peptide hormones, neuropeptides, and tachykinins, as well as in the digestion of otherwise resistant dietary protein fragments, thereby complementing the pancreatic peptidases. X-Prolyl Aminopeptidase is a member of the M24 family of metalloproteases, which also contains methionine aminopeptidases, X-Pro dipeptidase, aminopeptidase P2, aminopeptidase P homolog, proliferation-associated protein 1, and suppressor of Ty homolog or chromatin-specific transcription elongation factor large subunit. It is a soluble enzyme, in contrast to the GPI-anchored Aminopeptidase P2 encoded by XPNPEP2. Deficiency of X-Prolyl Aminopeptidase results in excretion of large amounts of imino-oligopeptides in urine. Human Aminopeptidase P1 is widely expressed. The amino acid sequence of human X-Prolyl Aminopeptidase is 99%, 97%, 95%, 74% and 73% identical to that of canine, bovine, mouse/rat, Xenopus and zebrafish, respectively.