| Recombinant Human Ubiquitin Carboxyl-Terminal Hydrolase 14/USP14 |
|
| Catalog# | C191 |
| Source | E. coli |
| Description | Recombinant Human Ubiquitin Carboxyl-Terminal Hydrolase 14/USP14 is produced by our E. coli expression system. The target protein is expressed with sequence (Asp91-Gln494) of Human USP14. |
| Names | Ubiquitin Carboxyl-Terminal Hydrolase 14, Deubiquitinating Enzyme 14, Ubiquitin Thioesterase 14, Ubiquitin-Specific-Processing Protease 14, USP14, TGT |
| Accession # | P54578 |
| Formulation | Supplied as a 0.2 μM filtered solution of 20mM Tris-HCl, 100mM NaCl, 20% Glycerol, pH 8.0 |
| Shipping | The product is shipped on dry ice/ice packs.
|
| Storage | Store at < -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles. |
| Purity | Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
|
| Endotoxin | Less than 0.1 ng/μg (1 IEU/μg). |
| Amino Acid Sequence | MGSSHHHHHHSSGLVPRGSHMDMTEEQLASAMELPCGLTNLGNTCYMNATVQCIRSVPELKDALK RYAGALRASGEMASAQYITAALRDLFDSMDKTSSSIPPIILLQFLHMAFPQFAEKGEQGQYLQQD ANECWIQMMRVLQQKLEAIEDDSVKETDSSSASAATPSKKKSLIDQFFGVEFETTMKCTESEEEE VTKGKENQLQLSCFINQEVKYLFTGLKLRLQEEITKQSPTLQRNALYIKSSKISRLPAYLTIQMV RFFYKEKESVNAKVLKDVKFPLMLDMYELCTPELQEKMVSFRSKFKDLEDKKVNQQPNTSDKKSS PQKEVKYEPFSFADDIGSNNCGYYDLQAVLTHQGRSSSSGHYVSWVKRKQDEWIKFDDDKVSIVT PEDILRLSGGGDWHIAYVLLYGPRRVEIMEEESEQ |
| Background | Ubiquitin Carboxyl-Terminal Hydrolase 14 (USP14) belongs to the ubiquitin-specific processing (USP) family which is a deubiquitinating enzyme (DUB) with His and Cys domains. USP14 located in the cytoplasm is a proteasome-associated deubiquitinase which releases ubiquitin from the proteasome targeted ubiquitinated proteins. USP14 acts also as a physiological inhibitor of endoplasmic reticulum-associated degradation (ERAD) under the non-stressed condition by inhibiting the degradation of unfolded endoplasmic reticulum proteins via interaction with ERN1. In addition, USP14 is indispensable for synaptic development and function at neuromuscular junctions, required for the degradation of the chemokine receptor CXCR4 which is critical for CXCL12-induced cell chemotaxis. |
| MSDS |  |