Recombinant Human Ubiquitin Carboxyl-Terminal Hydrolase 14/USP14
Our PriceQuantity

10ug/$70

50ug/$265

500ug/$1540

1mg/$2200

This is a new product. Please enter your email address below, and our service team will send you the data sheet.

We apologize for the inconvenience, and we are working at our best to update the missing information.

Your Email:

This is a new product. Please enter your email address below, and our service team will send you the MSDS.

We apologize for the inconvenience, and we are working at our best to update the missing information.

Your Email:

C191 has not been referenced in any publication so far.

We will update the citation once any published work comes in our awareness. Please check back!

Catalog#C191
SourceE. coli
DescriptionRecombinant Human Ubiquitin Carboxyl-Terminal Hydrolase 14/USP14 is produced by our E. coli expression system. The target protein is expressed with sequence (Asp91-Gln494) of Human USP14.
NamesUbiquitin Carboxyl-Terminal Hydrolase 14, Deubiquitinating Enzyme 14, Ubiquitin Thioesterase 14, Ubiquitin-Specific-Processing Protease 14, USP14, TGT
Accession #P54578
FormulationSupplied as a 0.2 μM filtered solution of 20mM Tris-HCl, 100mM NaCl, 20% Glycerol, pH 8.0
ShippingThe product is shipped on dry ice/ice packs.
StorageStore at < -20°C, stable for 6 months after receipt.
Please minimize freeze-thaw cycles.
PurityGreater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
EndotoxinLess than 0.1 ng/μg (1 IEU/μg).
Amino Acid Sequence
MGSSHHHHHHSSGLVPRGSHMDMTEEQLASAMELPCGLTNLGNTCYMNATVQCIRSVPELKDALK RYAGALRASGEMASAQYITAALRDLFDSMDKTSSSIPPIILLQFLHMAFPQFAEKGEQGQYLQQD ANECWIQMMRVLQQKLEAIEDDSVKETDSSSASAATPSKKKSLIDQFFGVEFETTMKCTESEEEE VTKGKENQLQLSCFINQEVKYLFTGLKLRLQEEITKQSPTLQRNALYIKSSKISRLPAYLTIQMV RFFYKEKESVNAKVLKDVKFPLMLDMYELCTPELQEKMVSFRSKFKDLEDKKVNQQPNTSDKKSS PQKEVKYEPFSFADDIGSNNCGYYDLQAVLTHQGRSSSSGHYVSWVKRKQDEWIKFDDDKVSIVT PEDILRLSGGGDWHIAYVLLYGPRRVEIMEEESEQ
BackgroundUbiquitin Carboxyl-Terminal Hydrolase 14 (USP14) belongs to the ubiquitin-specific processing (USP) family which is a deubiquitinating enzyme (DUB) with His and Cys domains. USP14 located in the cytoplasm is a proteasome-associated deubiquitinase which releases ubiquitin from the proteasome targeted ubiquitinated proteins. USP14 acts also as a physiological inhibitor of endoplasmic reticulum-associated degradation (ERAD) under the non-stressed condition by inhibiting the degradation of unfolded endoplasmic reticulum proteins via interaction with ERN1. In addition, USP14 is indispensable for synaptic development and function at neuromuscular junctions, required for the degradation of the chemokine receptor CXCR4 which is critical for CXCL12-induced cell chemotaxis.