Recombinant Human Uteroglobin-Related Protein 1/UGRP1
Our PriceQuantity

10ug/$105

50ug/$315

500ug/$1540

1mg/$2200

This is a new product. Please enter your email address below, and our service team will send you the data sheet.

We apologize for the inconvenience, and we are working at our best to update the missing information.

Your Email:

This is a new product. Please enter your email address below, and our service team will send you the MSDS.

We apologize for the inconvenience, and we are working at our best to update the missing information.

Your Email:

C190 has not been referenced in any publication so far.

We will update the citation once any published work comes in our awareness. Please check back!

Catalog#C190
SourceE. coli
DescriptionRecombinant Human Uteroglobin-Related Protein 1/UGRP1 is produced by our E. coli expression system. The target protein is expressed with sequence (Phe22-Val93) of Human UGRP1.
NamesSecretoglobin Family 3A Member 2, Pneumo Secretory Protein 1, PnSP-1, Uteroglobin-Related Protein 1, SCGB3A2, PNSP1, UGRP1
Accession #Q96PL1
FormulationLyophilized from a 0.2 μM filtered solution of 20mM PB, 150mM NaCl, pH 7.4
ShippingThe product is shipped at ambient temperature.
ReconstitutionAlways centrifuge tubes before opening. Do not mix by vortex or pipetting.
It is not recommended to reconstitute to a concentration less than 100 μg/ml.
Dissolve the lyophilized protein in 1X PBS.
Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
StorageLyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks.
Reconstituted protein solution can be stored at 4-7°C for 2-7 days.
Aliquots of reconstituted samples are stable at < -20°C for 3 months.
PurityGreater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
EndotoxinLess than 0.1 ng/μg (1 IEU/μg).
Amino Acid Sequence
FLINKVPLPVDKLAPLPLDNILPFMDPLKLLLKTLGISVEHLVEGLRKCVNELGPEASEAVKKLL EALSHLV
BackgroundUteroglobin-Related Protein 1 (UGRP1) belongs to the secretoglobin family which has been suggested to play a role in lung inflammation and allergic diseases. UGRP1 is a 17 kDa secreted homodimeric protein that shows amino acid sequence similarity with uteroglobin. UGRP1 is expressed predominantly in the lung and low levels of expression are detected in the thyroid. Expression of UGRP1 in lung epithelial cells is enhanced by IL-10 and decreased through the activities of IL-9 and IL-5. UGRP1 interacts with the macrophage scavenger receptor with collagenous structure which is expressed by alveolar macrophages in the lung. It have suggested that UGRP1 may be involved in inflammation and pathogen clearance in the lung by binding to its receptor.