| Recombinant Human Ubiquitin-Conjugating Enzyme E2 T/UBE2T |
|
| Catalog# | C187 |
| Source | E. coli |
| Description | Recombinant Human Ubiquitin-Conjugating Enzyme E2 T/UBE2T is produced by our E. coli expression system. The target protein is expressed with sequence (Met1-Val197) of Human UBE2T. |
| Names | Ubiquitin-Conjugating Enzyme E2 T, Cell Proliferation-Inducing Gene 50 Protein, Ubiquitin Carrier Protein T, Ubiquitin-Protein Ligase T, UBE2T |
| Accession # | Q9NPD8 |
| Formulation | Supplied as a 0.2 μM filtered solution of 50mM HEPES, 150mM NaCl, 2mM DTT, 10% Glycerol, pH 7.5 |
| Shipping | The product is shipped on dry ice/ice packs.
|
| Storage | Store at < -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles. |
| Purity | Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
|
| Endotoxin | Less than 0.1 ng/μg (1 IEU/μg). |
| Amino Acid Sequence | MGSSHHHHHHSSGLVPRGSHMQRASRLKRELHMLATEPPPGITCWQDKDQMDDLRAQILGGANTP YEKGVFKLEVIIPERYPFEPPQIRFLTPIYHPNIDSAGRICLDVLKLPPKGAWRPSLNIATVLTS IQLLMSEPNPDDPLMADISSEFKYNKPAFLKNARQWTEKHARQKQKADEEEMLDNLPEAGDSRVH NSTQKRKASQLVGIEKKFHPDV |
| Background | Ubiquitin-Conjugating Enzyme E2 T (UBE2T) is a ligase that belongs to the Ubiquitin-Conjugating Enzyme family. UBE2T accepts the ATP-dependent ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins. In vitro, UBE2T is able to catalyze polyubiquitination using all 7 ubiquitin Lys residues, but may prefer 'Lys-11'-, 'Lys-27'-, 'Lys-48'- and 'Lys-63'-linked polyubiquitination. UBE2T is an important factor of the Faconi anemia pathway of DNA damage repair and, upon self-inactivation, may negatively regulate the Faconi pathway. |
| MSDS |  |