Recombinant Human pro-Nerve Growth Factor/pro-NGF
Our PriceQuantity

10ug/$105

50ug/$315

500ug/$1540

1mg/$2200

This is a new product. Please enter your email address below, and our service team will send you the data sheet.

We apologize for the inconvenience, and we are working at our best to update the missing information.

Your Email:

This is a new product. Please enter your email address below, and our service team will send you the MSDS.

We apologize for the inconvenience, and we are working at our best to update the missing information.

Your Email:

C078 has not been referenced in any publication so far.

We will update the citation once any published work comes in our awareness. Please check back!

Catalog#C078
SourceE. coli
DescriptionRecombinant Human precursor form of Nerve Growth Factor/pro-NGF produced in E. coli is a non-glycosylated non-covalently linked homodimer with each polypeptide chain containing 222 amino acids with an extra N-terminal Met with a molecular mass of 25kD.
NamesBeta-Nerve Growth Factor, Beta-NGF, NGF, NGFB
Accession #P01138
FormulationLyophilized from a 0.2 μM filtered solution of 20mM PB, 250mM NaCl, pH 7.2
ShippingThe product is shipped at ambient temperature.
ReconstitutionAlways centrifuge tubes before opening. Do not mix by vortex or pipetting.
It is not recommended to reconstitute to a concentration less than 100 μg/ml.
Dissolve the lyophilized protein in 1X PBS.
Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
StorageLyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks.
Reconstituted protein solution can be stored at 4-7°C for 2-7 days.
Aliquots of reconstituted samples are stable at < -20°C for 3 months.
PurityGreater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
EndotoxinLess than 0.1 ng/μg (1 IEU/μg).
Amino Acid Sequence
MEPHSESNVPAGHTIPQAHWTKLQHSLDTALRRARSAPAAAIAARVAGQTRNITVDPRLFKKRRL RSPRVLFSTQPPREAADTQDLDFEVGGAAPFNRTHRSKRSSSHPIFHRGEFSVCDSVSVWVGDKT TATDIKGKEVMVLGEVNINNSVFKQYFFETKCRDPNPVDSGCRGIDSKHWNSYCTTTHTFVKALT MDGKQAAWRFIRIDTACVCVLSRKAVRRA
BackgroundThe precursor form of the nerve growth factor (proNGF) like its mature form is characterized by the cystin knot motif consisting of three cystine bridges, whereas proneurotrophins and mature neurotrophins elicit opposite biological effects. ProNGF functions preferentially via the complex of pan-neurotrophin receptor p75 (p75NTR) and vps10p domain-containing receptor sortilin inducing neuronal apoptosis and contributing to age- and disease-related neurodegeneration.