Catalog Number
10ug50ug500ug1mg
Quantity
The product is currently on sale. The sales price will be shown in the checkout process. Please see our current promotion page for more qualified products!

Recombinant Human Legumain
Our PriceQuantity

10ug/$150

50ug/$440

500ug/$1540

1mg/$2200

This is a new product. Please enter your email address below, and our service team will send you the data sheet.

We apologize for the inconvenience, and we are working at our best to update the missing information.

Your Email:

This is a new product. Please enter your email address below, and our service team will send you the MSDS.

We apologize for the inconvenience, and we are working at our best to update the missing information.

Your Email:

C371 has not been referenced in any publication so far.

We will update the citation once any published work comes in our awareness. Please check back!

Catalog#C371
SourceHEK293
DescriptionRecombinant Human Legumain produced by transfected human cells is a secreted protein with sequence (Ile18-Tyr433) of Human Legumain fused with a polyhistidine tag at the C-terminus.
NamesLegumain, Asparaginyl Endopeptidase, Protease Cysteine 1, LGMN, PRSC1
Accession #Q99538
FormulationSupplied as a 0.2 μM filtered solution of 20mM Tris-HCl, 150mM NaCl, 10% Glycerol, pH 8.0
ShippingThe product is shipped on dry ice/ice packs.
StorageStore at < -20°C, stable for 6 months after receipt.
Please minimize freeze-thaw cycles.
PurityGreater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
EndotoxinLess than 0.1 ng/μg (1 IEU/μg).
Amino Acid Sequence
IPIDDPEDGGKHWVVIVAGSNGWYNYRHQADACHAYQIIHRNGIPDEQIVVMMYDDIAYSEDNPT PGIVINRPNGTDVYQGVPKDYTGEDVTPQNFLAVLRGDAEAVKGIGSGKVLKSGPQDHVFIYFTD HGSTGILVFPNEDLHVKDLNETIHYMYKHKMYRKMVFYIEACESGSMMNHLPDNINVYATTAANP RESSYACYYDEKRSTYLGDWYSVNWMEDSDVEDLTKETLHKQYHLVKSHTNTSHVMQYGNKTIST MKVMQFQGMKRKASSPVPLPPVTHLDLTPSPDVPLTIMKRKLMNTNDLEESRQLTEEIQRHLDAR HLIEKSVRKIVSLLAASEAEVEQLLSERAPLTGHSCYPEALLHFRTHCFNWHSPTYEYALRHLYV LVNLCEKPYPLHRIKLSMDHVCLGHYVDHHHHHH
BackgroundLegumain is a lysosomal cysteine protease which is a member of the peptidase C13 family. Though it is found in many tissues, it is highly expressed in the kidney, heart, and placenta. Legumain has a strict specificity for hydrolysis of asparaginyl bonds and can also cleave aspartyl bonds slowly, especially under acidic conditions. Over-expression Legumain in tumors is significant for invasion and metastasis. In addition, Legumain may be involved in the processing of proteins for MHC class II antigen presentation in the lysosomal/endosomal system and negative regulation of neuron apoptosis.

Feedback,
Win a prize