| Recombinant Human C-X-C Motif Chemokine Ligand 10/CXCL10 | |
| Catalog# | C054 |
| Source | E. coli |
| Description | Recombinant Human C-X-C Motif Chemokine Ligand 10/CXCL10 is produced by E. coli transformed with a plasmid containing sequence (Val22-Pro98) of Human CXCL10. |
| Names | C-X-C Motif Chemokine 10, 10 kDa Interferon Gamma-Induced Protein, Gamma-IP10, IP-10, Small-Inducible Cytokine B10, CXCL10, INP10, SCYB10 |
| Accession # | P02778 |
| Formulation | Lyophilized from a 0.2 μM filtered solution of 20mM PB, 150mM NaCl, pH 7.0 |
| Shipping | The product is shipped at ambient temperature. |
| Reconstitution | Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
| Storage | Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months. |
| Biological Activity | ED50 is 0.02-0.06 μg/mL as determined by the ability of Recombinant CXCL10 to chemoattract human CXCR3 transfected BaF3 mouse proB cells. |
| Purity | Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
| Endotoxin | Less than 0.1 ng/μg (1 IEU/μg). |
| Amino Acid Sequence | VPLSRTVRCTCISISNQPVNPRSLEKLEIIPASQFCPRVEIIATMKKKGEKRCLNPESKAIKNLL KAVSKERSKRSP |
| Background | Human C-X-C Motif Chemokine Ligand 10 (CXCL10) is a non-ELR chemokine secreted by various cell types, such as monocytes, endothelial cells and fibroblasts, in response to IFN-γ. CXCL10 functions via chemokine receptor CXCR3. CXCL10 has been attributed to several roles, such as chemoattraction for activated T-lymphocytes, inhibition of angiogenesis, and antitumor activity. |
| MSDS |  |