Catalog Number
10ug50ug500ug1mg
Quantity

Recombinant Human Interleukin-10/IL-10
This item is currently unavailable with an estimated lead time of 1-2 months:Inquiry
novoprotein
Catalog#C027
SourceE. coli
DescriptionRecombinant Human Interleukin-10/IL-10 produced in E. coli is a single non-glycosylated polypeptide chain containing 160 amino acids with a molecular mass of 18,648 Daltons.
NamesInterleukin-10, IL-10, Cytokine Synthesis Inhibitory Factor, CSIF, IL10
Accession #P22301
FormulationLyophilized from a 0.2 μM filtered solution of 20mM PB, 300mM NaCl, pH 7.3
ShippingThe product is shipped at ambient temperature.
ReconstitutionAlways centrifuge tubes before opening. Do not mix by vortex or pipetting.
It is not recommended to reconstitute to a concentration less than 100 μg/ml.
Dissolve the lyophilized protein in 1X PBS.
Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
StorageLyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks.
Reconstituted protein solution can be stored at 4-7°C for 2-7 days.
Aliquots of reconstituted samples are stable at < -20°C for 3 months.
Biological ActivityED50 is less than 2 ng/ml as determined by the dose-dependent co-stimulation with murine IL-4 of MC-9 cells.
Specific Activity of 1.5 x 106 IU/mg.
PurityGreater than 95% as determined by RP-HPLC and reducing SDS-PAGE.
EndotoxinLess than 0.1 ng/μg (1 IEU/μg).
Amino Acid Sequence
MSPGQGTQSENSCTHFPGNLPNMLRDLRDAFSRVKTFFQMKDQLDNLLLKESLLEDFKGYLGCQA LSEMIQFYLEEVMPQAENQDPDIKAHVNSLGENLKTLRLRLRRCHRFLPCENKSKAVEQVKNAFN KLQEKGIYKAMSEFDIFINYIEAYMTMKIRN
Background