Catalog Number
10ug50ug500ug1mg
Quantity

Recombinant Human Interleukin-36 Receptor Antagonist Protein/IL-36RN
Our PriceQuantity

10ug/$150

50ug/$440

500ug/$1540

1mg/$2200

This is a new product. Please enter your email address below, and our service team will send you the data sheet.

We apologize for the inconvenience, and we are working at our best to update the missing information.

Your Email:

This is a new product. Please enter your email address below, and our service team will send you the MSDS.

We apologize for the inconvenience, and we are working at our best to update the missing information.

Your Email:

C071 has not been referenced in any publication so far.

We will update the citation once any published work comes in our awareness. Please check back!

Catalog#C071
SourceE. coli
DescriptionRecombinant Human Interleukin-36 Receptor Antagonist Protein/IL-36RN is produced with our E. coli expression system. The target protein is expressed with sequence (Met1-Asp155) of Human IL-36RN.
NamesInterleukin-36 Receptor Antagonist Protein, FIL1 Delta, IL-1-Related Protein 3, IL-1RP3, Interleukin-1 HY1, IL-1HY1, Interleukin-1 Delta, IL-1 Delta, Interleukin-1 Family Member 5, IL-1F5, Interleukin-1 Receptor Antagonist Homolog 1, IL-1ra Homolog 1, Int
Accession #Q9UBH0
FormulationLyophilized from a 0.2 μM filtered solution of 20mM Tris-HCl, 150mM NaCl, pH 7.5
ShippingThe product is shipped at ambient temperature.
ReconstitutionAlways centrifuge tubes before opening. Do not mix by vortex or pipetting.
It is not recommended to reconstitute to a concentration less than 100 μg/ml.
Dissolve the lyophilized protein in 1X PBS.
Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
StorageLyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks.
Reconstituted protein solution can be stored at 4-7°C for 2-7 days.
Aliquots of reconstituted samples are stable at < -20°C for 3 months.
PurityGreater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
EndotoxinLess than 0.1 ng/μg (1 IEU/μg).
Amino Acid Sequence
MVLSGALCFRMKDSALKVLYLHNNQLLAGGLHAGKVIKGEEISVVPNRWLDASLSPVILGVQGGS QCLSCGVGQEPTLTLEPVNIMELYLGAKESKSFTFYRRDMGLTSSFESAAYPGWFLCTVPEADQP VRLTQLPENGGWNAPITDFYFQQCD
BackgroundHuman Interleukin-36 Receptor Antagonist (IL-36RN) is a secreted protein which belongs to the Interleukin 1 cytokine family (IL-1 family). IL-36RN is predominantly expressed in keratinocytes but not in fibroblasts, endothelial cells or melanocytes. IL-36RN is also detected in the spleen, brain leukocyte and macrophage cell types. Increased in lesional psoriasis skin. IL-36RN is a highly and a specific antagonist of the IL-1 receptor-related protein 2-mediated response to Interleukin 1 family member 9 (IL1F9). Dysregulated expression of novel agonistic and antagonistic IL-1 family member ligands can promote cutaneous inflammation, revealing potential novel targets for the treatment of inflammatory skin disorders. Human and mouse IL-36RN share 90% sequence identity.