Recombinant Human Interleukin-11/IL-11
Our PriceQuantity

10ug/$150

50ug/$440

500ug/$1230

1mg/$1760

This is a new product. Please enter your email address below, and our service team will send you the data sheet.

We apologize for the inconvenience, and we are working at our best to update the missing information.

Your Email:

This is a new product. Please enter your email address below, and our service team will send you the MSDS.

We apologize for the inconvenience, and we are working at our best to update the missing information.

Your Email:

C006 has not been referenced in any publication so far.

We will update the citation once any published work comes in our awareness. Please check back!

Catalog#C006
SourceP. pastoris
DescriptionRecombinant Human Interleukin-11/IL-11 is produced in P. pastoris by recombinant DNA technology. The protein has a molecular mass of approximately 19,000 Daltons and is non-glycosylated. The protein is 177 amino acids in length and differs from the 178 amino acid length of native IL-11 by lacking the amino-terminal praline residue.
NamesInterleukin-11, IL-11, Adipogenesis Inhibitory Factor, AGIF, Oprelvekin, IL11
Accession #P20809
FormulationLyophilized from a 0.2 μM filtered solution of 20mM PB, 2% Glycine, pH 7.2
ShippingThe product is shipped at ambient temperature.
ReconstitutionAlways centrifuge tubes before opening. Do not mix by vortex or pipetting.
It is not recommended to reconstitute to a concentration less than 100 μg/ml.
Dissolve the lyophilized protein in 1X PBS.
Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
StorageLyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks.
Reconstituted protein solution can be stored at 4-7°C for 2-7 days.
Aliquots of reconstituted samples are stable at < -20°C for 3 months.
Biological ActivityED50 is less than 0.2 ng/ml as determined by the dose-dependent stimulation of murine 7TD1 proliferation.
Specific Activity of 8.0 x 106 IU/ mg.
PurityGreater than 95% as determined by RP-HPLC and reducing SDS-PAGE.
EndotoxinLess than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.
Amino Acid Sequence
PGPPPGPPRVSPDPRAELDSTVLLTRSLLADTRQLAAQLRDKFPADGDHNLDSLPTLAMSAGALG ALQLPGVLTRLRADLLSYLRHVQWLRRAGGSSLKTLEPELGTLQARLDRLLRRLQLLMSRLALPQ PPPDPPAPPLAPPSSAWGGIRAAHAILGGLHLTLDWAVRGLLLLKTRL
BackgroundInterleukin 11 (IL-11) is a thrombopoietic growth factor that directly stimulates the proliferation of hematopoietic stem cells and megakaryocyte progenitor cells and induces megakaryocyte maturation resulting in increased platelet production. IL-11 is a member of a family of human growth factors that includes human growth hormone, granulocyte colony-stimulating factor, and other growth factors.