Recombinant Phi32 DNA Polymerase
Our PriceQuantity

10ug/$105

50ug/$315

500ug/$1540

1mg/$2200

This is a new product. Please enter your email address below, and our service team will send you the data sheet.

We apologize for the inconvenience, and we are working at our best to update the missing information.

Your Email:

This is a new product. Please enter your email address below, and our service team will send you the MSDS.

We apologize for the inconvenience, and we are working at our best to update the missing information.

Your Email:

C158 has not been referenced in any publication so far.

We will update the citation once any published work comes in our awareness. Please check back!

Catalog#C158
SourceE. coli
DescriptionRecombinant Phi32 DNA Polymerase is produced with our E. coli expression system. The target protein is expressed with sequence of Phi32 DNA Polymerase.
NamesType I DNA Polymerase
Accession #B0FIN6
FormulationSupplied as a 0.2 μM filtered solution of 10mM Tris-HCl, 100mM KCl, 1mM DTT, 0.1mM EDTA, 0.5% Tween 20, 0.5% NP-40, 50% Glycerol, pH 7.4
ShippingThe product is shipped on dry ice/ice packs.
StorageStore at < -20°C, stable for 6 months after receipt.
Please minimize freeze-thaw cycles.
PurityGreater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
EndotoxinLess than 0.1 ng/μg (1 IEU/μg).
Amino Acid Sequence
MVKKKKKVFAFDIESNALYDDITKVWCIYIFDVETGERWGYRPHQIEDGIRKLTEADVLVGHNII DFDLPALKKMYPSLINYHFNVFDTLCLSRYLKPDRIGDSPEYPKGDPRRGPRGHGLKQWGEFLGE LKGDYGEQEEAWDAFTEDMFTYCEQDVNLTVKVYLFLCELTGFDPYDPPLYWKM
BackgroundPhi32 DNA Polymerase, also named Type I DNA polymerase, is a number of DNA polymerase. DNA polymerases are essential for DNA replication, and usually function in pairs while copying one double-stranded DNA molecule into two double-stranded DNAs in a process termed semiconservative DNA replication. DNA polymerases also play key roles in other processes within cells, including DNA repair, genetic recombination, reverse transcription, and the generation of antibody diversity via the specialized DNA polymerase, terminal deoxynucleotidyl transferase.