| Recombinant Human α B Crystallin Chain/CRYAB | |
| Catalog# | C118 |
| Source | E. coli |
| Description | Recombinant Human α B Crystallin Chain/CRYAB is produced with our E. coli expression system. The target protein is expressed with sequence (Met1-Lys175) of Human CRYAB. |
| Names | Alpha-Crystallin B Chain, Alpha(B)-Crystallin, Heat Shock Protein Beta-5, HspB5, Renal Carcinoma Antigen NY-REN-27, Rosenthal Fiber Component, CRYAB, CRYA2 |
| Accession # | P02511 |
| Formulation | Lyophilized from a 0.2 μM filtered solution of 20mM PB, 150mM NaCl, pH 7.2 |
| Shipping | The product is shipped at ambient temperature. |
| Reconstitution | Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
| Storage | Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months. |
| Purity | Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
| Endotoxin | Less than 0.1 ng/μg (1 IEU/μg). |
| Amino Acid Sequence | MDIAIHHPWIRRPFFPFHSPSRLFDQFFGEHLLESDLFPTSTSLSPFYLRPPSFLRAPSWFDTGL SEMRLEKDRFSVNLDVKHFSPEELKVKVLGDVIEVHGKHEERQDEHGFISREFHRKYRIPADVDP LTITSSLSSDGVLTVNGPRKQVSGPERTIPITREEKPAVTAAPKKLEHHHHHH |
| Background | α Crystallin B Chain (CRYAB) is a cytoplasmic protein that belongs to the small heat shock protein (HSP20) family. Alpha crystallins are composed of two gene products: alpha-A and alpha-B, for acidic and basic, respectively. Alpha crystallins can be induced by heat shock and are members of the small heat shock protein (sHSP also known as the HSP20) family. Alpha crystallins acts as molecular chaperones and hold them in in large soluble aggregates. CRYAB is expressed widely in many tissues and organs. It may contribute to the transparency and refractive index of the lens. The deficiency of CRYAB is the cause of myopathy myofibrillar type 2 (MFM2) and cataract posterior polar type 2 (CTPP2). |
| MSDS |  |