Recombinant Human C-C Motif Chemokine 28/CCL28
Our PriceQuantityData Sheet

10ug/$117

50ug/$350

500ug/$1230

1mg/$1760

novoprotein
Catalog#C095
SourceE. coli
DescriptionRecombinant Human C-C Motif Chemokine 28/CCL28 is produced with our E. coli expression system. The target protein is expressed with sequence (Ile20-Tyr127) of Human CCL28.
NamesC-C Motif Chemokine 28, Mucosae-Associated Epithelial Chemokine, MEC, Protein CCK1, Small-Inducible Cytokine A28, CCL28, SCYA28
Accession #Q9NRJ3
FormulationLyophilized from a 0.2 μM filtered solution of 20mM PB, 150mM NaCl, pH 7.2
ShippingThe product is shipped at ambient temperature.
ReconstitutionAlways centrifuge tubes before opening. Do not mix by vortex or pipetting.
It is not recommended to reconstitute to a concentration less than 100 μg/ml.
Dissolve the lyophilized protein in 1X PBS.
Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
StorageLyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks.
Reconstituted protein solution can be stored at 4-7°C for 2-7 days.
Aliquots of reconstituted samples are stable at < -20°C for 3 months.
PurityGreater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
EndotoxinLess than 0.1 ng/μg (1 IEU/μg).
Amino Acid Sequence
MSEAILPIASSCCTEVSHHISRRLLERVNMCRIQRADGDCDLAAVILHVKRRRICVSPHNHTVKQ WMKVQAAKKNGKGNVCHRKKHHGKRNSNRAHQGKHETYGHKTPY
BackgroundChemokine (C-C Motif) Ligand 28 (CCL28) is a novel chemokine that shares the most homology with CCL27/CTACK. CCL28 shows chemotactic activity for resting CD4, CD8 T-cells and eosinophils. It Binds to CCR3 and CCR10 and induces calcium mobilization in a dose-dependent manner. CCR10 (GPR2 orphan receptor) is also the receptor for CCL27/CTACK. CCL28 is preferentially expressed by epithelial cells of diverse tissues, with highest expression level in normal and pathological colon. It is also expressed in normal and asthmatic lung tissues. Human and mouse CCL28 shares 83% sequence identity in their mature regions.
MSDSnovoprotein