| Recombinant Human C-C Motif Chemokine 1/CCL1 | |
| Catalog# | C094 |
| Source | E. coli |
| Description | Recombinant Human C-C Motif Chemokine 1/CCL1 is produced with our E. coli expression system. The target protein is expressed with sequence (K24-K96) of Human CCL1. |
| Names | C-C Motif Chemokine 1, Small-Inducible Cytokine A1, T Lymphocyte-Secreted Protein I-309, CCL1, SCYA1 |
| Accession # | P22362 |
| Formulation | Lyophilized from a 0.2 μM filtered solution of 20mM PB, 150mM NaCl, pH 7.2 |
| Shipping | The product is shipped at ambient temperature. |
| Reconstitution | Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
| Storage | Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months. |
| Purity | Greater than 95% as determined by reducing SEC-HPLC and reducing SDS-PAGE. |
| Endotoxin | Less than 0.1 ng/μg (1 IEU/μg). |
| Amino Acid Sequence | MKSMQVPFSRCCFSFAEQEIPLRAILCYRNTSSICSNEGLIFKLKRGKEACALDTVGWVQRHRKM LRHCPSKRK |
| Background | Chemokine (C-C Motif) Ligand 1 (CCL1) is a small glycoprotein secreted by activated T cells, which play a central role during immunoregulatory and inflammaion processes. Human CCL1 has been assumed to be a homologue of the mouse TCA3. While the two proteins share only approximately 42% amino acid sequence identity, both chemokines contain an extra pair of cysteine residues not found in most other chemokines. CCL1 attracts monocytes, NK cells, and immature B cells and dendritic cells by interacting with cell surface chemokine receptor CCR8. CCL1 is identified as a potent inhibitor of HIV-1 envelope-mediated cell-cell fusion and virus infection. |
| MSDS |  |