Recombinant Human C-C Motif Chemokine 1/CCL1
Our PriceQuantityData Sheet

10ug/$150

50ug/$440

500ug/$1540

1mg/$2200

novoprotein
Catalog#C094
SourceE. coli
DescriptionRecombinant Human C-C Motif Chemokine 1/CCL1 is produced with our E. coli expression system. The target protein is expressed with sequence (K24-K96) of Human CCL1.
NamesC-C Motif Chemokine 1, Small-Inducible Cytokine A1, T Lymphocyte-Secreted Protein I-309, CCL1, SCYA1
Accession #P22362
FormulationLyophilized from a 0.2 μM filtered solution of 20mM PB, 150mM NaCl, pH 7.2
ShippingThe product is shipped at ambient temperature.
ReconstitutionAlways centrifuge tubes before opening. Do not mix by vortex or pipetting.
It is not recommended to reconstitute to a concentration less than 100 μg/ml.
Dissolve the lyophilized protein in 1X PBS.
Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
StorageLyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks.
Reconstituted protein solution can be stored at 4-7°C for 2-7 days.
Aliquots of reconstituted samples are stable at < -20°C for 3 months.
PurityGreater than 95% as determined by reducing SEC-HPLC and reducing SDS-PAGE.
EndotoxinLess than 0.1 ng/μg (1 IEU/μg).
Amino Acid Sequence
MKSMQVPFSRCCFSFAEQEIPLRAILCYRNTSSICSNEGLIFKLKRGKEACALDTVGWVQRHRKM LRHCPSKRK
BackgroundChemokine (C-C Motif) Ligand 1 (CCL1) is a small glycoprotein secreted by activated T cells, which play a central role during immunoregulatory and inflammaion processes. Human CCL1 has been assumed to be a homologue of the mouse TCA3. While the two proteins share only approximately 42% amino acid sequence identity, both chemokines contain an extra pair of cysteine residues not found in most other chemokines. CCL1 attracts monocytes, NK cells, and immature B cells and dendritic cells by interacting with cell surface chemokine receptor CCR8. CCL1 is identified as a potent inhibitor of HIV-1 envelope-mediated cell-cell fusion and virus infection.
MSDSnovoprotein