Recombinant Human Asialoglycoprotein Receptor 1/ASGPR1
Our PriceQuantityData Sheet

10ug/$80

50ug/$220

500ug/$1540

1mg/$2200

novoprotein
Catalog#C428
SourceHEK293
DescriptionRecombinant Human Asialoglycoprotein Receptor 1/ASGPR1 produced by transfected human cells is a secreted protein with sequence (Gln62-Ile291) of Human ASGPR1 fused with a polyhistidine tag at the C-terminus.
NamesAsialoglycoprotein Receptor 1, ASGP-R 1, ASGPR 1, C-Type Lectin Domain Family 4 Member H1, Hepatic Lectin H1, HL-1, ASGR1, CLEC4H1
Accession #P07306
FormulationLyophilized from a 0.2 μM filtered solution of 20mM PB, 150mM NaCl, pH 7.2
ShippingThe product is shipped at ambient temperature.
ReconstitutionAlways centrifuge tubes before opening. Do not mix by vortex or pipetting.
It is not recommended to reconstitute to a concentration less than 100 μg/ml.
Dissolve the lyophilized protein in 1X PBS.
Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
StorageLyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks.
Reconstituted protein solution can be stored at 4-7°C for 2-7 days.
Aliquots of reconstituted samples are stable at < -20°C for 3 months.
PurityGreater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
EndotoxinLess than 0.1 ng/μg (1 IEU/μg).
Amino Acid Sequence
QNSQLQEELRGLRETFSNFTASTEAQVKGLSTQGGNVGRKMKSLESQLEKQQKDLSEDHSSLLLH VKQFVSDLRSLSCQMAALQGNGSERTCCPVNWVEHERSCYWFSRSGKAWADADNYCRLEDAHLVV VTSWEEQKFVQHHIGPVNTWMGLHDQNGPWKWVDGTDYETGFKNWRPEQPDDWYGHGLGGGEDCA HFTDDGRWNDDVCQRPYRWVCETELDKASQEPPLLVDHHHHHH
BackgroundAsialoglycoprotein Receptor 1 (ASGPR1) is an endocytic recycling receptor, belongs to the long-form subfamily of the C-type/Ca2+-dependent lectin family. ASGPR consists of two noncovalently-linked subnits, ASGPR1 and ASGPR2. ASGPR1 mediates the endocytosis of plasma glycoproteins, recognizes terminal galactose and N-acetylgalactosamine units. When the ligand binds to to ASGPR1, results in the complex is internalized and transported to a sorting organelle, then ASGPR1 and ligand can be disassociated, ASGPR1 returns to the cell membrane surface.
MSDSnovoprotein