| Recombinant Human Asialoglycoprotein Receptor 1/ASGPR1 | |
| Catalog# | C428 |
| Source | HEK293 |
| Description | Recombinant Human Asialoglycoprotein Receptor 1/ASGPR1 produced by transfected human cells is a secreted protein with sequence (Gln62-Ile291) of Human ASGPR1 fused with a polyhistidine tag at the C-terminus. |
| Names | Asialoglycoprotein Receptor 1, ASGP-R 1, ASGPR 1, C-Type Lectin Domain Family 4 Member H1, Hepatic Lectin H1, HL-1, ASGR1, CLEC4H1 |
| Accession # | P07306 |
| Formulation | Lyophilized from a 0.2 μM filtered solution of 20mM PB, 150mM NaCl, pH 7.2 |
| Shipping | The product is shipped at ambient temperature. |
| Reconstitution | Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
| Storage | Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months. |
| Purity | Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
| Endotoxin | Less than 0.1 ng/μg (1 IEU/μg). |
| Amino Acid Sequence | QNSQLQEELRGLRETFSNFTASTEAQVKGLSTQGGNVGRKMKSLESQLEKQQKDLSEDHSSLLLH VKQFVSDLRSLSCQMAALQGNGSERTCCPVNWVEHERSCYWFSRSGKAWADADNYCRLEDAHLVV VTSWEEQKFVQHHIGPVNTWMGLHDQNGPWKWVDGTDYETGFKNWRPEQPDDWYGHGLGGGEDCA HFTDDGRWNDDVCQRPYRWVCETELDKASQEPPLLVDHHHHHH |
| Background | Asialoglycoprotein Receptor 1 (ASGPR1) is an endocytic recycling receptor, belongs to the long-form subfamily of the C-type/Ca2+-dependent lectin family. ASGPR consists of two noncovalently-linked subnits, ASGPR1 and ASGPR2. ASGPR1 mediates the endocytosis of plasma glycoproteins, recognizes terminal galactose and N-acetylgalactosamine units. When the ligand binds to to ASGPR1, results in the complex is internalized and transported to a sorting organelle, then ASGPR1 and ligand can be disassociated, ASGPR1 returns to the cell membrane surface. |
| MSDS |  |