Recombinant Human Amphoterin-Induced Protein 3/AMIGO3
Our PriceQuantity

10ug/$105

50ug/$315

500ug/$1540

1mg/$2200

This is a new product. Please enter your email address below, and our service team will send you the data sheet.

We apologize for the inconvenience, and we are working at our best to update the missing information.

Your Email:

This is a new product. Please enter your email address below, and our service team will send you the MSDS.

We apologize for the inconvenience, and we are working at our best to update the missing information.

Your Email:

C426 has not been referenced in any publication so far.

We will update the citation once any published work comes in our awareness. Please check back!

Catalog#C426
SourceHEK293
DescriptionRecombinant Human Amphoterin-Induced Protein 3/AMIGO3 produced by transfected human cells is a secreted protein with sequence (Thr20-Thr383) of Human AMIGO3 fused with a polyhistidine tag at the C-terminus.
NamesAmphoterin-Induced Protein 3, AMIGO-3, Alivin-3, AMIGO3, ALI3, KIAA1851
Accession #Q86WK7
FormulationLyophilized from a 0.2 μM filtered solution of 20mM PB, 150mM NaCl, pH 7.2
ShippingThe product is shipped at ambient temperature.
ReconstitutionAlways centrifuge tubes before opening. Do not mix by vortex or pipetting.
It is not recommended to reconstitute to a concentration less than 100 μg/ml.
Dissolve the lyophilized protein in 1X PBS.
Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
StorageLyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks.
Reconstituted protein solution can be stored at 4-7°C for 2-7 days.
Aliquots of reconstituted samples are stable at < -20°C for 3 months.
PurityGreater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
EndotoxinLess than 0.1 ng/μg (1 IEU/μg).
Amino Acid Sequence
TPDSEGFPPRALHNCPYKCICAADLLSCTGLGLQDVPAELPAATADLDLSHNALQRLRPGWLAPL FQLRALHLDHNELDALGRGVFVNASGLRLLDLSSNTLRALGRHDLDGLGALEKLLLFNNRLVHLD EHAFHGLRALSHLYLGCNELASFSFDHLHGLSATHLLTLDLSSNRLGHISVPELAALPAFLKNGL YLHNNPLPCDCRLYHLLQRWHQRGLSAVRDFAREYVCLAFKVPASRVRFFQHSRVFENCSSAPAL GLERPEEHLYALVGRSLRLYCNTSVPAMRIAWVSPQQELLRAPGSRDGSIAVLADGSLAIGNVQE QHAGLFVCLATGPRLHHNQTHEYNVSVHFPRPEPEAFNTVDHHHHHH
BackgroundAmphoterin-Induced Gene and ORF 3 (AMIGO3) is a member of the AMIGO family. AMIGO family proteins are cell adhesion molecules, which exhibits homophilic and heterophilic binding properties, plays an important role in neuronal axon tract development. AMIGO3 is a type I transmembrane proteins, includes six leucine-rich repeats (CRRs) and Ig domain in the extracellular domains. AMIGO3 can be expressed and detected in all tissues, may mediates heterophilic cell-cell interaction, contributes to signal transduction through its intracellular domain.