Recombinant Human Ubiquitin-Conjugating Enzyme E2 J2/UBE2J2
Our PriceQuantity

10ug/$150

50ug/$440

500ug/$1540

1mg/$2200

This is a new product. Please enter your email address below, and our service team will send you the data sheet.

We apologize for the inconvenience, and we are working at our best to update the missing information.

Your Email:

This is a new product. Please enter your email address below, and our service team will send you the MSDS.

We apologize for the inconvenience, and we are working at our best to update the missing information.

Your Email:

CE31 has not been referenced in any publication so far.

We will update the citation once any published work comes in our awareness. Please check back!

Catalog#CE31
SourceE. coli
DescriptionRecombinant Human Ubiquitin-Conjugating Enzyme E2 J2/UBE2J2 is produced by our E. coli expression system. Target protein is expressed with sequence (Glu124-Arg224) of Human UBE2J2 fused with a GST tag at the N-terminus.
NamesUbiquitin-Conjugating Enzyme E2 J2, Non-Canonical Ubiquitin-Conjugating Enzyme 2, NCUBE-2, UBE2J2, NCUBE2
Accession #Q8N2K1
FormulationSupplied as a 0.2 μM filtered solution of 20mM PB, 150mM NaCl, 1mM DTT, pH 7.2
ShippingThe product is shipped on dry ice/ice packs.
StorageStore at < -20°C, stable for 6 months after receipt.
Please minimize freeze-thaw cycles.
PurityGreater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
EndotoxinLess than 0.1 ng/μg (1 IEU/μg).
Amino Acid Sequence
MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKL TQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEML KMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKS SKYIAWPLQGWQATFGGGDHPPKSDLVPRGSPEFHMEKGPTLGSIETSDFTKRQLAVQSLAFNLK DKVFCELFPEVVEEIKQKQKAQDELSSRPQTLPLPDVVPDGETHLVQNGIQLLNGHAPGAVPNLA GLQQANR
BackgroundUbiquitin-Conjugating Enzyme E2 J2 (UBE2J2) belongs to the ubiquitin-conjugating enzyme family. UBE2J2 is involved in the ubiquitiantion. UBE2J2 located in the membrane of the endoplasmic reticulum, catalyzes the covalent attachment of ubiquitin to other proteins. UBE2J2 may play a important role in the selective degradation of misfolded membrane protein from the endoplasmic reticulum.