| Recombinant Human Ubiquitin-Associated Protein 1/UBAP1 | |
| Catalog# | CE46 |
| Source | E. coli |
| Description | Recombinant Human Ubiquitin-Associated Protein 1/UBAP1 is produced by our E. coli expression system. The target protein is expressed with sequence (Met1-Ser502) of Human UBAP1 fused with a 6His tag at the C-terminus. |
| Names | Ubiquitin-Associated Protein 1, UBAP-1, Nasopharyngeal Carcinoma-Associated Gene 20 Protein, UBAP1 |
| Accession # | Q9NZ09 |
| Formulation | Lyophilized from a 0.2 μM filtered solution of 20mM PB, 150mM NaCl, 1mM DTT, pH 7.4 |
| Shipping | The product is shipped at ambient temperature. |
| Reconstitution | Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
| Storage | Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months. |
| Purity | Greater than 95% as determined by reducing SDS-PAGE. |
| Endotoxin | Less than 0.1 ng/μg (1 IEU/μg). |
| Amino Acid Sequence | MASKKLGADFHGTFSYLDDVPFKTGDKFKTPAKVGLPIGFSLPDCLQVVREVQYDFSLEKKTIEW AEEIKKIEEAEREAECKIAEAEAKVNSKSGPEGDSKMSFSKTHSTATMPPPINPILASLQHNSIL TPTRVSSSATKQKVLSPPHIKADFNLADFECEEDPFDNLELKTIDEKEELRNILVGTTGPIMAQL LDNNLPRGGSGSVLQDEEVLASLERATLDFKPLHKPNGFITLPQLGNCEKMSLSSKVSLPPIPAV SNIKSLSFPKLDSDDSNQKTAKLASTFHSTSCLRNGTFQNSLKPSTQSSASELNGHHTLGLSALN LDSGTEMPALTSSQMPSLSVLSVCTEESSPPNTGPTVTPPNFSVSQVPNMPSCPQAYSELQMLSP SERQCVETVVNMGYSYECVLRAMKKKGENIEQILDYLFAHGQLCEKGFDPLLVEEALEMHQCSEE KMMEFLQLMSKFKEMGFELKDIKEVLLLHNNDQDNALEDLMARAGASLEHHHHHH |
| Background | Ubiquitin-Associated Protein 1 (UBAP1) belongs to the UBA domain family. Members of this family are related to ubiquitin and the ubiquitination pathway. Because of their cytogenetic location, this UBA domain family member is being studied as a putative target for mutation in nasopharyngeal carcinomas. UBAP1 is highly expressed in the heart, brain, placenta, lung, skeletal muscle, liver, and pancreas. UBAP1 consists of two UBA domains and one UMA domain. The ubiquitin associated domain is throught to be a non-covalent ubiquitin binding domain, including a compact three helix bundle. |
| MSDS |  |