| Recombinant Human Proenkephalin-A | |
| Catalog# | CA69 |
| Source | HEK293 |
| Description | Recombinant Human Proenkephalin-A/PENK is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Glu25-Phe267) of Human PENK fused with a polyhistidine tag at the C-terminus. |
| Names | Proenkephalin-A, Synenkephalin, Met-Enkephalin, Leu-Enkephalin, PENK |
| Accession # | P01210 |
| Shipping | The product is shipped on dry ice/ice packs. |
| Purity | Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
| Endotoxin | Less than 0.1 ng/μg (1 IEU/μg). |
| Amino Acid Sequence | ECSQDCATCSYRLVRPADINFLACVMECEGKLPSLKIWETCKELLQLSKPELPQDGTSTLRENSK PEESHLLAKRYGGFMKRYGGFMKKMDELYPMEPEEEANGSEILAKRYGGFMKKDAEEDDSLANSS DLLKELLETGDNRERSHHQDGSDNEEEVSKRYGGFMRGLKRSPQLEDEAKELQKRYGGFMRRVGR PEWWMDYQKRYGGFLKRFAEALPSDEEGESYSKEVPEMEKRYGGFMRFVDHHHHHH |
| Background | Proenkephalin-A is a secreted protein that belongs to the opioid neuropeptide precursor family. Proenkephalin-A is an endogenous opioid polypeptide hormone which, via proteolyic cleavage, produces the enkephalin peptides [Met]enkephalin, and to a lesser extent, [Leu]enkephalin. Met- and Leu-enkephalins compete with and mimic the effects of opiate drugs. They play a role in a number of physiologic functions, including pain perception and responses to stress. Proenkephalin-A (114-133) and Proenkephalin-A (237-258) increase glutamate release in the striatum. Proenkephalin-A (114-133) decreases GABA concentration in the striatum. |
| MSDS |  |