Catalog Number
10ug50ug500ug1mg
Quantity

Recombinant Human Protocadherin α-6/PCDHA6
This item is currently unavailable with an estimated lead time of 1-2 months:Inquiry
novoprotein
Catalog#C817
SourceHEK293
DescriptionRecombinant Human Protocadherin α-6/PCDHA6 is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Gln30-Asn697) of Human PCDHA6 fused with a 6His tag at the C-terminus.
NamesProtocadherin Alpha-6, PCDH-Alpha-6, PCDHA6, CNRS2
Accession #Q9UN73
ShippingThe product is shipped on dry ice/ice packs.
PurityGreater than 95% as determined by reducing SDS-PAGE.
EndotoxinLess than 0.1 ng/μg (1 IEU/μg).
Amino Acid Sequence
QLHYSVPEEAKHGTFVGRIAQDLGLELAELVPRLFRMASKDREDLLEVNLQNGILFVNSRIDREE LCGRSAECSIHLEVIVDRPLQVFHVDVEVRDINDNPPLFPVEEQRVLIYESRLPDSVFPLEGASD ADVGSNSILTYKLSSSEYFGLDVKINSDDNKQIGLLLKKSLDREEAPAHNLFLTATDGGKPELTG TVQLLVTVLDVNDNAPTFEQSEYEVRIFENADNGTTVIRLNASDRDEGANGAISYSFNSLVAAMV IDHFSIDRNTGEIVIRGNLDFEQENLYKILIDATDKGHPPMAGHCTVLVRILDKNDNVPEIALTS LSLPVREDAQFGTVIALISVNDLDSGANGQVNCSLTPHVPFKLVSTFKNYYSLVLDSALDRESVS AYELVVTARDGGSPSLWATASLSVEVADMNDNAPAFAQPEYTVFVKENNPPGCHIFTVSARDADA QENALVSYSLVERRVGERALSSYISVHAESGKVYALQPLDHEELELLQFQVSARDAGVPPLGSNV TLQVFVLDENDNAPALLAPRVGGTGGAVSELVPRSLGAGQVVAKVRAVDADSGYNAWLSYELQPP ASSARFPFRVGLYTGEISTTRVLDEADSPRHRLLVLVKDHGEPALTATATVLVSLVESGQAPKAS SRASVGAAGPEAALVDVNVDHHHHHH
BackgroundProtocadherin α-6 (PCDHA6) is a single-pass type I membrane protein that contains six cadherin domains. PCDHA6 is a member of the protocadherin α gene cluster. The α gene cluster is composed of 15 cadherin superfamily genes related to CNR genes and consists of 13 highly similar and 2 more distantly related coding sequences. PCDHA6 is a potential calcium-dependent cell-adhesion protein. PCDHA6 may be involved in the establishment and maintenance of specific neuronal connections in the brain. These neural cadherin-like cell adhesion proteins are integral plasma membrane proteins that most likely play a critical role in the establishment and function of specific cell-cell connections in the brain.