| Recombinant Human Interleukin-8/IL-8 (3-79) | |
| Catalog# | C037 |
| Source | E. coli |
| Description | Recombinant Human Interleukin-8/IL-8 (3-79) produced in E. coli is a single non-glycosylated polypeptide chain containing 77 amino acids with a molecular mass of 8,904 Daltons. |
| Names | Interleukin-8, IL-8, C-X-C Motif Chemokine 8, Emoctakin, Granulocyte Chemotactic Protein 1, GCP-1, Monocyte-Derived Neutrophil Chemotactic Factor, MDNCF, Monocyte-Derived Neutrophil-Activating Peptide, MONAP, Neutrophil-Activating Protein 1, NAP-1, Protei |
| Accession # | P10145 |
| Formulation | Lyophilized from a 0.2 μM filtered solution of 20mM PB, 150mM NaCl, pH 7.4 |
| Shipping | The product is shipped at ambient temperature. |
| Reconstitution | Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
| Storage | Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months. |
| Biological Activity | Recombinant IL-8 (3-79) is fully biologically active when compared to standards. ED50 is less than 2 ng/ml as determined by its chemotaxis of hCXCR-2 transfected mouse BaF/3 cells. Specific Activity of 5.0 x 105 IU/mg. |
| Purity | Greater than 95% as determined by RP-HPLC and reducing SDS-PAGE. |
| Endotoxin | Less than 0.1 ng/μg (1 IEU/μg). |
| Amino Acid Sequence | AVLPRSAKELRCQCIKTYSKPFHPKFIKELRVIESGPHCANTEIIVKLSDGRELCLDPKENWVQR VVEKFLKRAENS |
| Background | Interleukin-8 (IL-8) belongs to the neutrophil-specific CXC family of chemokines. It is one of the initial cytokines released from a variety of cell types, including T cells, endothelial cells and fibroblasts, in response to an inflammatory stimulus and acts by recruiting neutrophils, T-cells and basophils to the site of inflammation. Elevated Interleukin-8 levels are associated with the onset of a variety of disease states. |
| MSDS |  |