Recombinant Human Isopentenyl Pyrophosphate Isomerase 2/IPP Isomerase 2
Our PriceQuantity

10ug/$150

50ug/$440

500ug/$1540

1mg/$2200

This is a new product. Please enter your email address below, and our service team will send you the data sheet.

We apologize for the inconvenience, and we are working at our best to update the missing information.

Your Email:

This is a new product. Please enter your email address below, and our service team will send you the MSDS.

We apologize for the inconvenience, and we are working at our best to update the missing information.

Your Email:

CE49 has not been referenced in any publication so far.

We will update the citation once any published work comes in our awareness. Please check back!

Catalog#CE49
SourceE. coli
DescriptionRecombinant Human Isopentenyl Pyrophosphate Isomerase 2/IPP Isomerase 2 is produced by our E. coli expression system. The target protein is expressed with sequence (Met1-Val227) of Human IDI2 fused with a 6His tag at the N-terminus.
NamesIsopentenyl-Diphosphate Delta-Isomerase 2, Isopentenyl Pyrophosphate Isomerase 2, IPP Isomerase 2, IPPI2, IDI2
Accession #Q9BXS1
FormulationSupplied as a 0.2 μM filtered solution of 20mM Tris-HCl, 1mM DTT, 0.1mM PMSF, pH 8.0
ShippingThe product is shipped on dry ice/ice packs.
StorageStore at < -20°C, stable for 6 months after receipt.
Please minimize freeze-thaw cycles.
PurityGreater than 95% as determined by reducing SDS-PAGE.
EndotoxinLess than 0.1 ng/μg (1 IEU/μg).
Amino Acid Sequence
MGSSHHHHHHSSGLVPRGSHMSDINLDWVDRRQLQRLEEMLIVVDENDKVIGADTKRNCHLNENI EKGLLHRAFSVVLFNTKNRILIQQRSDTKVTFPGYFTDSCSSHPLYNPAELEEKDAIGVRRAAQR RLQAELGIPGEQISPEDIVFMTIYHHKAKSDRIWGEHEICYLLLVRKNVTLNPDPSETKSILYLS QEELWELLEREARGEVKVTPWLRTIAERFLYRWWPHLDDVTPFVELHKIHRV
BackgroundIsopentenyl Pyrophosphate Isomerase 2 (IDI2) belongs to the IPP isomerase type 1 family. Both isozymes, IDI1 and IDI2 are localized to the peroxisome by a PTS1-dependent pathway. IDI2 is expressed in skeletal muscle, which contains one nudix hydrolase domain. IDI2 binds one magnesium per subunit. IDI2 catalyzes the 1,3-allylic rearrangement of the homoallylic substrate isopentenyl (IPP) to its highly electrophilic allylic isomer, dimethylallyl diphosphate (DMAPP). It is reported that IDI2 is regulated independently from IDI1, by a mechanism that may involve PPAR-α.