Catalog Number
10ug50ug500ug1mg
Quantity

Recombinant Human Isopentenyl Pyrophosphate Isomerase 2/IPP Isomerase 2
This item is currently unavailable with an estimated lead time of 1-2 months:Inquiry
novoprotein
Catalog#CE49
SourceE. coli
DescriptionRecombinant Human Isopentenyl Pyrophosphate Isomerase 2/IPP Isomerase 2 is produced by our E. coli expression system. The target protein is expressed with sequence (Met1-Val227) of Human IDI2 fused with a 6His tag at the N-terminus.
NamesIsopentenyl-Diphosphate Delta-Isomerase 2, Isopentenyl Pyrophosphate Isomerase 2, IPP Isomerase 2, IPPI2, IDI2
Accession #Q9BXS1
FormulationSupplied as a 0.2 μm filtered solution of 20mM Tris-HCl, 1mM DTT, 0.1mM PMSF, pH 8.0
ShippingThe product is shipped on dry ice/ice packs.
StorageStore at < -20°C, stable for 6 months after receipt.
Please minimize freeze-thaw cycles.
PurityGreater than 95% as determined by reducing SDS-PAGE.
EndotoxinLess than 0.1 ng/μg (1 IEU/μg).
Amino Acid Sequence
MGSSHHHHHHSSGLVPRGSHMSDINLDWVDRRQLQRLEEMLIVVDENDKVIGADTKRNCHLNENI EKGLLHRAFSVVLFNTKNRILIQQRSDTKVTFPGYFTDSCSSHPLYNPAELEEKDAIGVRRAAQR RLQAELGIPGEQISPEDIVFMTIYHHKAKSDRIWGEHEICYLLLVRKNVTLNPDPSETKSILYLS QEELWELLEREARGEVKVTPWLRTIAERFLYRWWPHLDDVTPFVELHKIHRV
BackgroundIsopentenyl Pyrophosphate Isomerase 2 (IDI2) belongs to the IPP isomerase type 1 family. Both isozymes, IDI1 and IDI2 are localized to the peroxisome by a PTS1-dependent pathway. IDI2 is expressed in skeletal muscle, which contains one nudix hydrolase domain. IDI2 binds one magnesium per subunit. IDI2 catalyzes the 1,3-allylic rearrangement of the homoallylic substrate isopentenyl (IPP) to its highly electrophilic allylic isomer, dimethylallyl diphosphate (DMAPP). It is reported that IDI2 is regulated independently from IDI1, by a mechanism that may involve PPAR-α.

Feedback,
Win a prize