Recombinant Human Hyaluronidase-1/HYAL1
This item is currently unavailable with an estimated lead time of 1-2 months:Inquiry
novoprotein
Catalog#CA81
SourceHEK293
DescriptionRecombinant Human Hyaluronidase-1/HYAL1 is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Phe22-Trp435) of Human HYAL1 fused with a polyhistidine tag at the C-terminus.
NamesHyaluronidase-1, Hyal-1, Hyaluronoglucosaminidase-1, Lung Carcinoma Protein 1, LuCa-1, HYAL1, LUCA1
Accession #Q12794
ShippingThe product is shipped on dry ice/ice packs.
PurityGreater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
EndotoxinLess than 0.1 ng/μg (1 IEU/μg).
Amino Acid Sequence
FRGPLLPNRPFTTVWNANTQWCLERHGVDVDVSVFDVVANPGQTFRGPDMTIFYSSQLGTYPYYT PTGEPVFGGLPQNASLIAHLARTFQDILAAIPAPDFSGLAVIDWEAWRPRWAFNWDTKDIYRQRS RALVQAQHPDWPAPQVEAVAQDQFQGAARAWMAGTLQLGRALRPRGLWGFYGFPDCYNYDFLSPN YTGQCPSGIRAQNDQLGWLWGQSRALYPSIYMPAVLEGTGKSQMYVQHRVAEAFRVAVAAGDPNL PVLPYVQIFYDTTNHFLPLDELEHSLGESAAQGAAGVVLWVSWENTRTKESCQAIKEYMDTTLGP FILNVTSGALLCSQALCSGHGRCVRRTSHPKALLLLNPASFSIQLTPGGGPLSLRGALSLEDQAQ MAVEFKCRCYPGWQAPWCERKSMWVDHHHHHH
BackgroundHyaluronidase-1 (HYAL1) is a secreted lysosomal hyaluronidase that belongs to the glycosyl hydrolase 56 family. HYAL1 contains one EGF-like domain and is highly expressed in the liver, kidney, and heart, but it is weakly expressed in the lung, placenta, and skeletal muscle. HYAL1 is thought to be involved in cell proliferation, migration, and differentiation. It may play a role in promoting tumor progression and blocking the TGFB1-enhanced cell growth. Mutations in HYAL1 are associated with mucopolysaccharidosis type IX, or hyaluronidase deficiency.