Recombinant Human Peroxisomal Multifunctional Enzyme Type 2/HSD17B4
This item is currently unavailable with an estimated lead time of 1-2 months:Inquiry
novoprotein
Catalog#C951
SourceHEK293
DescriptionRecombinant Human Peroxisomal Multifunctional Enzyme Type 2/HSD17B4 is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Gly2-Leu736) of Human HSD17B4 fused with a polyhistidine tag at the C-terminus.
NamesPeroxisomal Multifunctional Enzyme Type 2, MFE-2, 17-Beta-Hydroxysteroid Dehydrogenase 4, 17-Beta-HSD 4, D-Bifunctional Protein, DBP, Multifunctional Protein 2, MPF-2, (3R)-Hydroxyacyl-CoA Dehydrogenase, Enoyl-CoA Hydratase 2, 3-Alpha,7-Alpha,12-Alpha-Tri
Accession #P51659
ShippingThe product is shipped on dry ice/ice packs.
PurityGreater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
EndotoxinLess than 0.1 ng/μg (1 IEU/μg).
Amino Acid Sequence
MGSPLRFDGRVVLVTGAGAGLGRAYALAFAERGALVVVNDLGGDFKGVGKGSLAADKVVEEIRRR GGKAVANYDSVEEGEKVVKTALDAFGRIDVVVNNAGILRDRSFARISDEDWDIIHRVHLRGSFQV TRAAWEHMKKQKYGRIIMTSSASGIYGNFGQANYSAAKLGLLGLANSLAIEGRKSNIHCNTIAPN AGSRMTQTVMPEDLVEALKPEYVAPLVLWLCHESCEENGGLFEVGAGWIGKLRWERTLGAIVRQK NHPMTPEAVKANWKKICDFENASKPQSIQESTGSIIEVLSKIDSEGGVSANHTSRATSTATSGFA GAIGQKLPPFSYAYTELEAIMYALGVGASIKDPKDLKFIYEGSSDFSCLPTFGVIIGQKSMMGGG LAEIPGLSINFAKVLHGEQYLELYKPLPRAGKLKCEAVVADVLDKGSGVVIIMDVYSYSEKELIC HNQFSLFLVGSGGFGGKRTSDKVKVAVAIPNRPPDAVLTDTTSLNQAALYRLSGDWNPLHIDPNF ASLAGFDKPILHGLCTFGFSARRVLQQFADNDVSRFKAIKARFAKPVYPGQTLQTEMWKEGNRIH FQTKVQETGDIVISNAYVDLAPTSGTSAKTPSEGGKLQSTFVFEEIGRRLKDIGPEVVKKVNAVF EWHITKGGNIGAKWTIDLKSGSGKVYQGPAKGAADTTIILSDEDFMEVVLGKLDPQKAFFSGRLK ARGNIMLSQKLQMILKDYAKLVDHHHHHH
BackgroundPeroxisomal Multifunctional Enzyme Type 2 (MFE-2) belongs to the short-chain dehydrogenase/reductase (SDR) family. MFE-2 localizes to the peroxisome and contains one MaoC-like domain and one SCP2 domain. MFE-2 can be cleaved into (3R)-hydroxyacyl-CoA dehydrogenase and Enoyol-CoA hydratase 2 chains. MFE-2 acts as a bifunctional enzyme acting on the peroxisomal beta-oxidation pathway for fatty acids. It catalyzes the formation of 3-ketoacyl-CoA intermediates from both straight-chain and 2-methyl-branched-chain fatty acids. Defects in MFE-2 are a cause of D-bifunctional protein deficiency, which is a disorder of peroxisomal fatty acid β-oxidation.