Recombinant Human N-Acetyllactosaminide β-1,3-N-Acetylglucosaminyltransferase/B3GNT1
Our PriceQuantity

10ug/$105

50ug/$315

500ug/$1540

1mg/$2200

This is a new product. Please enter your email address below, and our service team will send you the data sheet.

We apologize for the inconvenience, and we are working at our best to update the missing information.

Your Email:

This is a new product. Please enter your email address below, and our service team will send you the MSDS.

We apologize for the inconvenience, and we are working at our best to update the missing information.

Your Email:

C963 has not been referenced in any publication so far.

We will update the citation once any published work comes in our awareness. Please check back!

Catalog#C963
SourceHEK293
DescriptionRecombinant Human N-Acetyllactosaminide β-1,3-N-Acetylglucosaminyltransferase/B3GNT1 is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Asp43-Cys415) of Human B3GNT1 fused with a polyhistidine tag at the C-terminus.
NamesN-Acetyllactosaminide Beta-1,3-N-Acetylglucosaminyltransferase, I-Beta-1,3-N-Acetylglucosaminyltransferase, iGnT, Poly-N-Acetyllactosamine Extension Enzyme, UDP-GlcNAc:BetaGal Beta-1,3-N-Acetylglucosaminyltransferase 1, B3GNT1, B3GNT6
Accession #O43505
FormulationLyophilized from a 0.2 μM filtered solution of PBS, pH 7.4
ShippingThe product is shipped at ambient temperature.
ReconstitutionAlways centrifuge tubes before opening. Do not mix by vortex or pipetting.
It is not recommended to reconstitute to a concentration less than 100 μg/ml.
Dissolve the lyophilized protein in 1X PBS.
Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
StorageLyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks.
Reconstituted protein solution can be stored at 4-7°C for 2-7 days.
Aliquots of reconstituted samples are stable at < -20°C for 3 months.
PurityGreater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
EndotoxinLess than 0.1 ng/µg (1 IEU/µg).
Amino Acid Sequence
DQYFEFFPPSPRSVDQVKAQLRTALASGGVLDASGDYRVYRGLLKTTMDPNDVILATHASVDNLL HLSGLLERWEGPLSVSVFAATKEEAQLATVLAYALSSHCPDMRARVAMHLVCPSRYEAAVPDPRE PGEFALLRSCQEVFDKLARVAQPGINYALGTNVSYPNNLLRNLAREGANYALVIDVDMVPSEGLW RGLREMLDQSNQWGGTALVVPAFEIRRARRMPMNKNELVQLYQVGEVRPFYYGLCTPCQAPTNYS RWVNLPEESLLRPAYVVPWQDPWEPFYVAGGKVPTFDERFRQYGFNRISQACELHVAGFDFEVLN EGFLVHKGFKEALKFHPQKEAENQHNKILYRQFKQELKAKYPNSPRRCVDHHHHHH
BackgroundN-Acetyllactosaminide β-1,3-N-Acetylglucosaminyltransferase (B3GNT1) is a member of the β-1,3-N-Acetylglucosaminyltransferase family. B3GNT1 is a single-pass type II membrane protein and widely expressed in many tissues. B3GNT1 can initiate the synthesis or the elongation of the linear poly-N-acetyllactosaminoglycans. B3GNT1 is essential for the synthesis of poly-N-acetyllactosamine, a determinant for the blood group i antigen. It can initiate the synthesis or the elongation of the linear poly-N-acetyllactosaminoglycans.