| Recombinant Human Apolipoprotein A-IV/ApoA4 | |
| Catalog# | CA08 |
| Source | HEK293 |
| Description | Recombinant Human Apolipoprotein A4/APOA4 is produced with our mammalian expression system in human cells. The target protein is expressed with sequence (Glu21-Ser396) of Human APOA4 fused with a 6His tag at the C-terminus. |
| Names | Apolipoprotein A-IV, Apo-AIV, ApoA-IV, Apolipoprotein A4, APOA4 |
| Accession # | P06727 |
| Formulation | Lyophilized from a 0.2 μM filtered solution of 20mM PB, 150mM NaCl, pH 7.2 |
| Shipping | The product is shipped at ambient temperature. |
| Reconstitution | Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
| Storage | Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months. |
| Purity | Greater than 95% as determined by reducing SDS-PAGE. |
| Endotoxin | Less than 0.1 ng/μg (1 IEU/μg). |
| Amino Acid Sequence | EVSADQVATVMWDYFSQLSNNAKEAVEHLQKSELTQQLNALFQDKLGEVNTYAGDLQKKLVPFAT ELHERLAKDSEKLKEEIGKELEELRARLLPHANEVSQKIGDNLRELQQRLEPYADQLRTQVNTQA EQLRRQLTPYAQRMERVLRENADSLQASLRPHADELKAKIDQNVEELKGRLTPYADEFKVKIDQT VEELRRSLAPYAQDTQEKLNHQLEGLTFQMKKNAEELKARISASAEELRQRLAPLAEDVRGNLRG NTEGLQKSLAELGGHLDQQVEEFRRRVEPYGENFNKALVQQMEQLRQKLGPHAGDVEGHLSFLEK DLRDKVNSFFSTFKEKESQDKTLSLPELEQQQEQQQEQQQEQVQMLAPLESVDHHHHHH |
| Background | Apolipoprotein A4 (APOA4) is a secreted protein that belongs to the apolipoprotein A1/A4/E family. Apoa-IV is a major component of HDL and chylomicrons. APOA4 is secreted into circulation on the surface of newly synthesized chylomicron particles. APOA4 play a role in the regulation of appetite and satiety in rodent models. APOA4 involved in chylomicrons and VLDL secretion and catabolism and required for efficient activation of lipoprotein lipase by ApoC-II. In addition, APOA4 is a potent activator of lecithin-cholesterol acyltransferase in vitro. |
| MSDS |  |