Recombinant Human Amyloid β A4 Precursor Protein-Binding Family A Member 3/APBA3
Our PriceQuantityData Sheet

10ug/$150

50ug/$440

500ug/$1540

1mg/$2200

novoprotein
Catalog#CE16
SourceE. coli
DescriptionRecombinant Human Amyloid β A4 Precursor Protein-Binding Family A Member 3/APBA3 is produced by our E. coli expression system. The target protein is expressed with sequence (Met1-Leu138) of Human APBA3 fused with a 6His tag at the C-terminus.
NamesAmyloid Beta A4 Precursor Protein-Binding Family A Member 3, Adapter protein X11Gamma, Neuron-Specific X11L2 Protein, Neuronal Munc18-1-Interacting Protein 3, Mint-3, APBA3, MINT3, X11L2
Accession #O96018
FormulationLyophilized from a 0.2 μM filtered solution of 20mM PB ,150mM NaCl, pH 7.2
ShippingThe product is shipped at ambient temperature.
ReconstitutionAlways centrifuge tubes before opening. Do not mix by vortex or pipetting.
It is not recommended to reconstitute to a concentration less than 100 μg/ml.
Dissolve the lyophilized protein in 1X PBS.
Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
StorageLyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks.
Reconstituted protein solution can be stored at 4-7°C for 2-7 days.
Aliquots of reconstituted samples are stable at < -20°C for 3 months.
PurityGreater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
EndotoxinLess than 0.1 ng/μg (1 IEU/μg).
Amino Acid Sequence
MDFPTISRSPSGPPAMDLEGPRDILVPSEDLTPDSQWDPMPGGPGSLSRMELDESSLQELVQQFE ALPGDLVGPSPGGAPCPLHIATGHGLASQEIADAHGLLSAEAGRDDLLGLLHCEECPPSQTGPEE PLEPAPRLLEHHHHHH
BackgroundAmyloid β A4 Precursor Protein-Binding Family A Member 3 (APBA3) is an adapter protein that belongs to the X11 family. APBA3 contains 2 PDZ (DHR) domains and 1 PID domain and interacts with the Alzheimer's disease amyloid precursor protein.. APBA3 is believed to be involved in signal transduction processes. Unlike X11-α and -β which are generally neuronal proteins, APBA3 is widely expressed in all tissues examined with lower levels in brain and testis. It binds to the cytoplasmic domain of amyloid protein (APP) in vivo and may modulate processing of the β-amyloid precursor protein (APP) and hence formation of β-APP.
MSDSnovoprotein