Recombinant Human ADP-Ribosylarginine Hydrolase/ADPRH
Our PriceQuantity

10ug/$150

50ug/$440

500ug/$1540

1mg/$2200

This is a new product. Please enter your email address below, and our service team will send you the data sheet.

We apologize for the inconvenience, and we are working at our best to update the missing information.

Your Email:

This is a new product. Please enter your email address below, and our service team will send you the MSDS.

We apologize for the inconvenience, and we are working at our best to update the missing information.

Your Email:

CE44 has not been referenced in any publication so far.

We will update the citation once any published work comes in our awareness. Please check back!

Catalog#CE44
SourceE. coli
DescriptionRecombinant Human ADP-Ribosylarginine Hydrolase/ADPRH is produced by our E. coli expression system. The target protein is expressed with sequence (Met1-Leu357) of Human ADPRH fused with a 6His tag at the N-terminus.
Names[Protein ADP-Ribosylarginine] Hydrolase, ADP-Ribosylarginine Hydrolase, ADP-Ribose-L-Arginine Cleaving Enzyme, ADPRH, ARH1
Accession #P54922
FormulationSupplied as a 0.2 μM filtered solution of 20mM PB, 150mM NaCl, 50% Glycerol, pH 7.4
ShippingThe product is shipped on dry ice/ice packs.
StorageStore at < -20°C, stable for 6 months after receipt.
Please minimize freeze-thaw cycles.
PurityGreater than 95% as determined by reducing SDS-PAGE.
EndotoxinLess than 0.1 ng/μg (1 IEU/μg).
Amino Acid Sequence
MGSSHHHHHHSSGLVPRGSHMEKYVAAMVLSAAGDALGYYNGKWEFLQDGEKIHRQLAQLGGLDA LDVGRWRVSDDTVMHLATAEALVEAGKAPKLTQLYYLLAKHYQDCMEDMDGRAPGGASVHNAMQL KPGKPNGWRIPFNSHEGGCGAAMRAMCIGLRFPHHSQLDTLIQVSIESGRMTHHHPTGYLGALAS ALFTAYAVNSRPPLQWGKGLMELLPEAKKYIVQSGYFVEENLQHWSYFQTKWENYLKLRGILDGE SAPTFPESFGVKERDQFYTSLSYSGWGGSSGHDAPMIAYDAVLAAGDSWKELAHRAFFHGGDSDS TAAIAGCWWGVMYGFKGVSPSNYEKLEYRNRLEETARALYSLGSKEDTVISL
BackgroundADP-Ribosylarginine Hydrolase (ADPRH) belongs to the ADP-Ribosylglycohydrolase family. ADPRH catalyzes removal of mono-ADP-ribose from arginine residues of proteins in the ADP-Ribosylation cycle, which is a post-translation modification that includes the addition of one or more ADP-ribose moieties. These reactions are related to cell signaling and the control of many cell processes, such as DNA repair and cell apoptosis. In addition, ADPRH binds with magnesium ion and possess ADP-ribosylarginine hydrolase activity.