| Recombinant Human ADP-Ribosylarginine Hydrolase/ADPRH | |
| Catalog# | CE44 |
| Source | E. coli |
| Description | Recombinant Human ADP-Ribosylarginine Hydrolase/ADPRH is produced by our E. coli expression system. The target protein is expressed with sequence (Met1-Leu357) of Human ADPRH fused with a 6His tag at the N-terminus. |
| Names | [Protein ADP-Ribosylarginine] Hydrolase, ADP-Ribosylarginine Hydrolase, ADP-Ribose-L-Arginine Cleaving Enzyme, ADPRH, ARH1 |
| Accession # | P54922 |
| Formulation | Supplied as a 0.2 μM filtered solution of 20mM PB, 150mM NaCl, 50% Glycerol, pH 7.4 |
| Shipping | The product is shipped on dry ice/ice packs. |
| Storage | Store at < -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles. |
| Purity | Greater than 95% as determined by reducing SDS-PAGE. |
| Endotoxin | Less than 0.1 ng/μg (1 IEU/μg). |
| Amino Acid Sequence | MGSSHHHHHHSSGLVPRGSHMEKYVAAMVLSAAGDALGYYNGKWEFLQDGEKIHRQLAQLGGLDA LDVGRWRVSDDTVMHLATAEALVEAGKAPKLTQLYYLLAKHYQDCMEDMDGRAPGGASVHNAMQL KPGKPNGWRIPFNSHEGGCGAAMRAMCIGLRFPHHSQLDTLIQVSIESGRMTHHHPTGYLGALAS ALFTAYAVNSRPPLQWGKGLMELLPEAKKYIVQSGYFVEENLQHWSYFQTKWENYLKLRGILDGE SAPTFPESFGVKERDQFYTSLSYSGWGGSSGHDAPMIAYDAVLAAGDSWKELAHRAFFHGGDSDS TAAIAGCWWGVMYGFKGVSPSNYEKLEYRNRLEETARALYSLGSKEDTVISL |
| Background | ADP-Ribosylarginine Hydrolase (ADPRH) belongs to the ADP-Ribosylglycohydrolase family. ADPRH catalyzes removal of mono-ADP-ribose from arginine residues of proteins in the ADP-Ribosylation cycle, which is a post-translation modification that includes the addition of one or more ADP-ribose moieties. These reactions are related to cell signaling and the control of many cell processes, such as DNA repair and cell apoptosis. In addition, ADPRH binds with magnesium ion and possess ADP-ribosylarginine hydrolase activity. |
| MSDS |  |